SCOPe 2.07: Domain d2ctea1: 2cte A:8-88

Lineage for d2ctea1 (2cte A:8-88)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
   beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
   an RNA-binding domain

6. Protein Vigilin [54797] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54798] (8 PDB entries)

8. Domain d2ctea1: 2cte A:8-88 [130794]
   Other proteins in same PDB: d2ctea2, d2ctea3

Details for d2ctea1

PDB Entry: 2cte

PDB Description: solution structure of the 1st kh type i domain from human vigilin

PDB Compounds: (A:) Vigilin

SCOPe Domain Sequences for d2ctea1:

Sequence; same for both SEQRES and ATOM records:

>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]}
divarlqtqasatvaipkehhrfvigkngeklqdlelktatkiqiprpddpsnqikitgt
kegiekarhevllisaeqdkr

Timeline for d2ctea1:

• d2ctea1 first appeared in SCOP 1.73
  
• d2ctea1 appears in SCOPe 2.06
  
• d2ctea1 appears in the current release, SCOPe 2.08