Lineage for d2ctea1 (2cte A:8-88)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722630Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 722631Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 722632Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (13 proteins)
    an RNA-binding domain
  6. 722697Protein Vigilin [54797] (1 species)
  7. 722698Species Human (Homo sapiens) [TaxId:9606] [54798] (8 PDB entries)
  8. 722703Domain d2ctea1: 2cte A:8-88 [130794]

Details for d2ctea1

PDB Entry: 2cte (more details)

PDB Description: Solution structure of the 1st KH type I domain from human Vigilin
PDB Compounds: (A:) Vigilin

SCOP Domain Sequences for d2ctea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]}
divarlqtqasatvaipkehhrfvigkngeklqdlelktatkiqiprpddpsnqikitgt
kegiekarhevllisaeqdkr

SCOP Domain Coordinates for d2ctea1:

Click to download the PDB-style file with coordinates for d2ctea1.
(The format of our PDB-style files is described here.)

Timeline for d2ctea1: