![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily) beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) ![]() Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
![]() | Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins) an RNA-binding domain |
![]() | Protein Vigilin [54797] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54798] (8 PDB entries) |
![]() | Domain d2ctea1: 2cte A:8-88 [130794] Other proteins in same PDB: d2ctea2, d2ctea3 |
PDB Entry: 2cte (more details)
SCOPe Domain Sequences for d2ctea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} divarlqtqasatvaipkehhrfvigkngeklqdlelktatkiqiprpddpsnqikitgt kegiekarhevllisaeqdkr
Timeline for d2ctea1: