Lineage for d2ct7a1 (2ct7 A:8-80)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037528Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 3037529Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 3037636Family g.44.1.4: IBR domain [144228] (1 protein)
    Smart 00647; RING-associated domain
    automatically mapped to Pfam PF01485
  6. 3037637Protein Ring finger protein 31 [144229] (1 species)
  7. 3037638Species Human (Homo sapiens) [TaxId:9606] [144230] (1 PDB entry)
    Uniprot Q96EP0 779-851
  8. 3037639Domain d2ct7a1: 2ct7 A:8-80 [130791]
    Other proteins in same PDB: d2ct7a2, d2ct7a3
    complexed with zn

Details for d2ct7a1

PDB Entry: 2ct7 (more details)

PDB Description: solution structure of the ibr domain of the ring finger protein 31 protein
PDB Compounds: (A:) RING finger protein 31

SCOPe Domain Sequences for d2ct7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]}
alfhkkltegvlmrdpkflwcaqcsfgfiyereqleatcpqchqtfcvrckrqweeqhrg
rscedfqnwkrmn

SCOPe Domain Coordinates for d2ct7a1:

Click to download the PDB-style file with coordinates for d2ct7a1.
(The format of our PDB-style files is described here.)

Timeline for d2ct7a1: