![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
![]() | Superfamily g.44.1: RING/U-box [57850] (7 families) ![]() |
![]() | Family g.44.1.4: IBR domain [144228] (1 protein) Smart 00647; RING-associated domain automatically mapped to Pfam PF01485 |
![]() | Protein Ring finger protein 31 [144229] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [144230] (1 PDB entry) Uniprot Q96EP0 779-851 |
![]() | Domain d2ct7a1: 2ct7 A:8-80 [130791] Other proteins in same PDB: d2ct7a2, d2ct7a3 complexed with zn |
PDB Entry: 2ct7 (more details)
SCOPe Domain Sequences for d2ct7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} alfhkkltegvlmrdpkflwcaqcsfgfiyereqleatcpqchqtfcvrckrqweeqhrg rscedfqnwkrmn
Timeline for d2ct7a1: