Class g: Small proteins [56992] (94 folds) |
Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) |
Family g.37.1.6: BED zinc finger [144157] (1 protein) Pfam PF02892; contains extra N-terminal and C-terminal helices bundled together with the core helix |
Protein Zinc finger BED domain-containing protein 1 [144158] (1 species) dREF homolog |
Species Human (Homo sapiens) [TaxId:9606] [144159] (1 PDB entry) Uniprot O96006 23-82 |
Domain d2ct5a1: 2ct5 A:8-67 [130790] Other proteins in same PDB: d2ct5a2, d2ct5a3 complexed with zn |
PDB Entry: 2ct5 (more details)
SCOPe Domain Sequences for d2ct5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ct5a1 g.37.1.6 (A:8-67) Zinc finger BED domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} skvwkyfgfdtnaegcilqwkkiycricmaqiaysgntsnlsyhleknhpeefcefvksn
Timeline for d2ct5a1: