Lineage for d2cswa1 (2csw A:8-139)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779760Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 1779761Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 1779795Family b.26.1.2: FHA domain [49885] (12 proteins)
  6. 1779858Protein Ubiquitin ligase protein RNF8 [141141] (1 species)
  7. 1779859Species Human (Homo sapiens) [TaxId:9606] [141142] (1 PDB entry)
    Uniprot O76064 8-139
  8. 1779860Domain d2cswa1: 2csw A:8-139 [130787]

Details for d2cswa1

PDB Entry: 2csw (more details)

PDB Description: solution structure of the fha domain of human ubiquitin ligase protein rnf8
PDB Compounds: (A:) Ubiquitin ligase protein RNF8

SCOPe Domain Sequences for d2cswa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cswa1 b.26.1.2 (A:8-139) Ubiquitin ligase protein RNF8 {Human (Homo sapiens) [TaxId: 9606]}
vtgdraggrswclrrvgmsagwllledgcevtvgrgfgvtyqlvskicplmisrnhcvlk
qnpegqwtimdnkslngvwlnrarleplrvysihqgdyiqlgvplenkenaeyeyevtee
dwetiypclspk

SCOPe Domain Coordinates for d2cswa1:

Click to download the PDB-style file with coordinates for d2cswa1.
(The format of our PDB-style files is described here.)

Timeline for d2cswa1: