Lineage for d2cswa1 (2csw A:8-139)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 793944Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 793945Superfamily b.26.1: SMAD/FHA domain [49879] (4 families) (S)
    has a few short helices inserted in loops
  5. 793979Family b.26.1.2: FHA domain [49885] (11 proteins)
  6. 794042Protein Ubiquitin ligase protein RNF8 [141141] (1 species)
  7. 794043Species Human (Homo sapiens) [TaxId:9606] [141142] (2 PDB entries)
    Uniprot O76064 8-139
  8. 794045Domain d2cswa1: 2csw A:8-139 [130787]

Details for d2cswa1

PDB Entry: 2csw (more details)

PDB Description: Solution structure of the FHA domain of human ubiquitin ligase protein RNF8
PDB Compounds: (A:) Ubiquitin ligase protein RNF8

SCOP Domain Sequences for d2cswa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cswa1 b.26.1.2 (A:8-139) Ubiquitin ligase protein RNF8 {Human (Homo sapiens) [TaxId: 9606]}
vtgdraggrswclrrvgmsagwllledgcevtvgrgfgvtyqlvskicplmisrnhcvlk
qnpegqwtimdnkslngvwlnrarleplrvysihqgdyiqlgvplenkenaeyeyevtee
dwetiypclspk

SCOP Domain Coordinates for d2cswa1:

Click to download the PDB-style file with coordinates for d2cswa1.
(The format of our PDB-style files is described here.)

Timeline for d2cswa1: