Lineage for d2cswa1 (2csw A:8-139)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778062Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2778063Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2778110Family b.26.1.2: FHA domain [49885] (12 proteins)
  6. 2778173Protein Ubiquitin ligase protein RNF8 [141141] (1 species)
  7. 2778174Species Human (Homo sapiens) [TaxId:9606] [141142] (1 PDB entry)
    Uniprot O76064 8-139
  8. 2778175Domain d2cswa1: 2csw A:8-139 [130787]
    Other proteins in same PDB: d2cswa2, d2cswa3

Details for d2cswa1

PDB Entry: 2csw (more details)

PDB Description: solution structure of the fha domain of human ubiquitin ligase protein rnf8
PDB Compounds: (A:) Ubiquitin ligase protein RNF8

SCOPe Domain Sequences for d2cswa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cswa1 b.26.1.2 (A:8-139) Ubiquitin ligase protein RNF8 {Human (Homo sapiens) [TaxId: 9606]}
vtgdraggrswclrrvgmsagwllledgcevtvgrgfgvtyqlvskicplmisrnhcvlk
qnpegqwtimdnkslngvwlnrarleplrvysihqgdyiqlgvplenkenaeyeyevtee
dwetiypclspk

SCOPe Domain Coordinates for d2cswa1:

Click to download the PDB-style file with coordinates for d2cswa1.
(The format of our PDB-style files is described here.)

Timeline for d2cswa1: