Lineage for d2csub1 (2csu B:1-129)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106576Family c.2.1.8: CoA-binding domain [51900] (6 proteins)
  6. 2106577Protein Acetate-CoA ligase alpha chain, AcdA, N-terminal domain [141936] (1 species)
  7. 2106578Species Pyrococcus horikoshii [TaxId:53953] [141937] (1 PDB entry)
    Uniprot O58493 1-129
  8. 2106580Domain d2csub1: 2csu B:1-129 [130784]
    Other proteins in same PDB: d2csua2, d2csua3, d2csub2, d2csub3
    automated match to d2csua1

Details for d2csub1

PDB Entry: 2csu (more details), 2.2 Å

PDB Description: Crystal structure of PH0766 from Pyrococcus horikoshii OT3
PDB Compounds: (B:) 457aa long hypothetical protein

SCOPe Domain Sequences for d2csub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2csub1 c.2.1.8 (B:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
mldyffnpkgiavigasndpkklgyevfknlkeykkgkvypvnikeeevqgvkayksvkd
ipdeidlaiivvpkrfvkdtliqcgekgvkgvviitagfgetgeegkreekelveiahky
gmriigpnc

SCOPe Domain Coordinates for d2csub1:

Click to download the PDB-style file with coordinates for d2csub1.
(The format of our PDB-style files is described here.)

Timeline for d2csub1: