Lineage for d2cssa1 (2css A:8-115)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2786051Protein Regulating synaptic membrane exocytosis protein 1, RIMS1 [141279] (2 species)
  7. 2786052Species Human (Homo sapiens) [TaxId:9606] [141281] (1 PDB entry)
    Uniprot Q86UR5 585-694
  8. 2786053Domain d2cssa1: 2css A:8-115 [130780]
    Other proteins in same PDB: d2cssa2, d2cssa3

Details for d2cssa1

PDB Entry: 2css (more details)

PDB Description: solution structure of the pdz domain of human kiaa0340 protein
PDB Compounds: (A:) Regulating synaptic membrane exocytosis protein 1

SCOPe Domain Sequences for d2cssa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]}
vtwqpskegdrligrvilnkrttmpkdsgallglkvvggkmtdlgrlgafitkvkkgsla
dvvghlragdevlewngkplpgatneevyniilesksepqveiivsrp

SCOPe Domain Coordinates for d2cssa1:

Click to download the PDB-style file with coordinates for d2cssa1.
(The format of our PDB-style files is described here.)

Timeline for d2cssa1: