![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein Rim binding protein 2 [141043] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141044] (1 PDB entry) Uniprot O15034 477-593 |
![]() | Domain d2cspa1: 2csp A:8-124 [130779] |
PDB Entry: 2csp (more details)
SCOPe Domain Sequences for d2cspa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} vefstlpagppappqdvtvqagvtpatirvswrppvltptglsnganvtgygvyakgqrv aevifptadstavelvrlrsleakgvtvrtlsaqgesvdsavaavppellvpptphp
Timeline for d2cspa1: