Lineage for d2cspa1 (2csp A:8-124)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2762110Protein Rim binding protein 2 [141043] (1 species)
  7. 2762111Species Human (Homo sapiens) [TaxId:9606] [141044] (1 PDB entry)
    Uniprot O15034 477-593
  8. 2762112Domain d2cspa1: 2csp A:8-124 [130779]
    Other proteins in same PDB: d2cspa2, d2cspa3

Details for d2cspa1

PDB Entry: 2csp (more details)

PDB Description: solution structure of the fniii domain of human rim-binding protein 2
PDB Compounds: (A:) RIM binding protein 2

SCOPe Domain Sequences for d2cspa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]}
vefstlpagppappqdvtvqagvtpatirvswrppvltptglsnganvtgygvyakgqrv
aevifptadstavelvrlrsleakgvtvrtlsaqgesvdsavaavppellvpptphp

SCOPe Domain Coordinates for d2cspa1:

Click to download the PDB-style file with coordinates for d2cspa1.
(The format of our PDB-style files is described here.)

Timeline for d2cspa1: