Lineage for d2csoa1 (2cso A:8-122)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761866Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) (S)
    contains a small beta-sheet (wing)
  5. 762577Family a.4.5.31: DEP domain [63483] (4 proteins)
    membrane-binding domain
  6. 762578Protein Pleckstrin [101039] (2 species)
  7. 762579Species Human (Homo sapiens) [TaxId:9606] [116790] (2 PDB entries)
    Uniprot P08567 125-219 # structure of the N-terminal PH domain (1-105) is also known ((50741))
  8. 762580Domain d2csoa1: 2cso A:8-122 [130778]

Details for d2csoa1

PDB Entry: 2cso (more details)

PDB Description: solution structure of the dep domain of human pleckstrin
PDB Compounds: (A:) Pleckstrin

SCOP Domain Sequences for d2csoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2csoa1 a.4.5.31 (A:8-122) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}
rsirlpetidlgalylsmkdtekgikelnlekdkkifnhcftgncvidwlvsnqsvrnrq
eglmiassllnegylqpagdmsksavdgtaenpfldnpdafyyfpdsgffceens

SCOP Domain Coordinates for d2csoa1:

Click to download the PDB-style file with coordinates for d2csoa1.
(The format of our PDB-style files is described here.)

Timeline for d2csoa1: