Lineage for d2csoa1 (2cso A:8-121)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2306510Family a.4.5.31: DEP domain [63483] (5 proteins)
    membrane-binding domain
  6. 2306511Protein Pleckstrin [101039] (2 species)
  7. 2306512Species Human (Homo sapiens) [TaxId:9606] [116790] (2 PDB entries)
    Uniprot P08567 125-219 # structure of the N-terminal PH domain (1-105) is also known (50741)
  8. 2306513Domain d2csoa1: 2cso A:8-121 [130778]
    Other proteins in same PDB: d2csoa2, d2csoa3

Details for d2csoa1

PDB Entry: 2cso (more details)

PDB Description: Solution structure of the DEP domain of human pleckstrin
PDB Compounds: (A:) Pleckstrin

SCOPe Domain Sequences for d2csoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2csoa1 a.4.5.31 (A:8-121) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}
rsirlpetidlgalylsmkdtekgikelnlekdkkifnhcftgncvidwlvsnqsvrnrq
eglmiassllnegylqpagdmsksavdgtaenpfldnpdafyyfpdsgffceen

SCOPe Domain Coordinates for d2csoa1:

Click to download the PDB-style file with coordinates for d2csoa1.
(The format of our PDB-style files is described here.)

Timeline for d2csoa1: