SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2csoa1 (2cso A:8-121)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983086Family a.4.5.31: DEP domain [63483] (5 protein domains)
    membrane-binding domain
  6. 1983087Protein Pleckstrin [101039] (2 species)
  7. 1983088Species Human (Homo sapiens) [TaxId:9606] [116790] (2 PDB entries)
    Uniprot P08567 125-219 # structure of the N-terminal PH domain (1-105) is also known (50741)
  8. 1983089Domain d2csoa1: 2cso A:8-121 [130778]
    Other proteins in same PDB: d2csoa2, d2csoa3

Details for d2csoa1

PDB Entry: 2cso (more details)

PDB Description: Solution structure of the DEP domain of human pleckstrin
PDB Compounds: (A:) Pleckstrin

SCOPe Domain Sequences for d2csoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2csoa1 a.4.5.31 (A:8-121) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}
rsirlpetidlgalylsmkdtekgikelnlekdkkifnhcftgncvidwlvsnqsvrnrq
eglmiassllnegylqpagdmsksavdgtaenpfldnpdafyyfpdsgffceen

SCOPe Domain Coordinates for d2csoa1:

Click to download the PDB-style file with coordinates for d2csoa1.
(The format of our PDB-style files is described here.)

Timeline for d2csoa1: