![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.1: YjgF-like [55298] (4 families) ![]() forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
![]() | Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins) some members possess an endoribonuclease activity inhibiting mRNA translation |
![]() | Protein automated matches [190254] (5 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [187037] (1 PDB entry) |
![]() | Domain d2cslb_: 2csl B: [130773] Other proteins in same PDB: d2csla1 automated match to d1xrga_ |
PDB Entry: 2csl (more details), 2.5 Å
SCOPe Domain Sequences for d2cslb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cslb_ d.79.1.1 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} meavktdrapaaigpyaqavkaggfvfvsgqiplapdgslvegdirvqtervmenlkavl eaagsglsrvvqttcfladmedfpgfnevyaryftppyparatvavkalprgvrvevacv alae
Timeline for d2cslb_: