Lineage for d2csla1 (2csl A:1-124)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525086Superfamily d.79.1: YjgF-like [55298] (3 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2525087Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins)
    some members possess an endoribonuclease activity inhibiting mRNA translation
  6. 2525168Protein Putative translation intiation inhibitor TTHA0137 [143529] (1 species)
  7. 2525169Species Thermus thermophilus [TaxId:274] [143530] (1 PDB entry)
    Uniprot Q5SM06 1-124
  8. 2525170Domain d2csla1: 2csl A:1-124 [130772]
    Other proteins in same PDB: d2cslb_, d2cslc_, d2csld_, d2csle_, d2cslf_

Details for d2csla1

PDB Entry: 2csl (more details), 2.5 Å

PDB Description: Crystal structure of TTHA0137 from Thermus Thermophilus HB8
PDB Compounds: (A:) protein translation initiation inhibitor

SCOPe Domain Sequences for d2csla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2csla1 d.79.1.1 (A:1-124) Putative translation intiation inhibitor TTHA0137 {Thermus thermophilus [TaxId: 274]}
meavktdrapaaigpyaqavkaggfvfvsgqiplapdgslvegdirvqtervmenlkavl
eaagsglsrvvqttcfladmedfpgfnevyaryftppyparatvavkalprgvrvevacv
alae

SCOPe Domain Coordinates for d2csla1:

Click to download the PDB-style file with coordinates for d2csla1.
(The format of our PDB-style files is described here.)

Timeline for d2csla1: