| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.1: YjgF-like [55298] (4 families) ![]() forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
| Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins) some members possess an endoribonuclease activity inhibiting mRNA translation |
| Protein Putative translation intiation inhibitor TTHA0137 [143529] (1 species) |
| Species Thermus thermophilus [TaxId:274] [143530] (1 PDB entry) Uniprot Q5SM06 1-124 |
| Domain d2csla1: 2csl A:1-124 [130772] Other proteins in same PDB: d2cslb_, d2cslc_, d2csld_, d2csle_, d2cslf_ |
PDB Entry: 2csl (more details), 2.5 Å
SCOPe Domain Sequences for d2csla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2csla1 d.79.1.1 (A:1-124) Putative translation intiation inhibitor TTHA0137 {Thermus thermophilus [TaxId: 274]}
meavktdrapaaigpyaqavkaggfvfvsgqiplapdgslvegdirvqtervmenlkavl
eaagsglsrvvqttcfladmedfpgfnevyaryftppyparatvavkalprgvrvevacv
alae
Timeline for d2csla1: