Lineage for d2csja1 (2csj A:8-111)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666573Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 666574Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 666575Family b.36.1.1: PDZ domain [50157] (46 proteins)
    Pfam PF00595
  6. 666821Protein Tight junction protein ZO-2, Tjp2 [141265] (1 species)
  7. 666822Species Mouse (Mus musculus) [TaxId:10090] [141266] (1 PDB entry)
  8. 666823Domain d2csja1: 2csj A:8-111 [130771]

Details for d2csja1

PDB Entry: 2csj (more details)

PDB Description: Solution structure of N-terminal PDZ domain from mouse TJP2
PDB Compounds: (A:) Tjp2 protein

SCOP Domain Sequences for d2csja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]}
meeviweqytvtlqkdskrgfgiavsggrdnphfengetsivisdvlpggpadgllqend
rvvmvngtpmedvlhsfavqqlrksgkiaaivvkrprkvqvapl

SCOP Domain Coordinates for d2csja1:

Click to download the PDB-style file with coordinates for d2csja1.
(The format of our PDB-style files is described here.)

Timeline for d2csja1: