Lineage for d2csja1 (2csj A:8-111)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2786217Protein Tight junction protein ZO-2, Tjp2 [141265] (1 species)
  7. 2786218Species Mouse (Mus musculus) [TaxId:10090] [141266] (1 PDB entry)
    Uniprot Q9Z0U1 1-104
  8. 2786219Domain d2csja1: 2csj A:8-111 [130771]
    Other proteins in same PDB: d2csja2, d2csja3

Details for d2csja1

PDB Entry: 2csj (more details)

PDB Description: solution structure of n-terminal pdz domain from mouse tjp2
PDB Compounds: (A:) Tjp2 protein

SCOPe Domain Sequences for d2csja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]}
meeviweqytvtlqkdskrgfgiavsggrdnphfengetsivisdvlpggpadgllqend
rvvmvngtpmedvlhsfavqqlrksgkiaaivvkrprkvqvapl

SCOPe Domain Coordinates for d2csja1:

Click to download the PDB-style file with coordinates for d2csja1.
(The format of our PDB-style files is described here.)

Timeline for d2csja1: