SCOP 1.75: Domain d2csha1: 2csh A:8-60

Lineage for d2csha1 (2csh A:8-60)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
   simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC

4. Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (7 families)

5. Family g.37.1.1: Classic zinc finger, C2H2 [57668] (30 proteins)

6. Protein Zinc finger protein 297b [144145] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [144146] (1 PDB entry)
   Uniprot O43298 370-422! Uniprot O43298 423-486

8. Domain d2csha1: 2csh A:8-60 [130769]
   complexed with zn

Details for d2csha1

PDB Entry: 2csh

PDB Description: solution structure of tandem repeat of the zf-c2h2 domains of human zinc finger protein 297b

PDB Compounds: (A:) Zinc finger protein 297B

SCOP Domain Sequences for d2csha1:

Sequence; same for both SEQRES and ATOM records:

>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]}
dklypcqcgksfthksqrdrhmsmhlglrpygcgvcgkkfkmkhhlvghmkih

Timeline for d2csha1:

• d2csha1 first appeared in SCOP 1.73
  
• d2csha1 appears in SCOPe 2.01
  
• d2csha1 appears in the current release, SCOPe 2.08