Class g: Small proteins [56992] (90 folds) |
Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (7 families) |
Family g.37.1.1: Classic zinc finger, C2H2 [57668] (30 proteins) |
Protein Zinc finger protein 297b [144145] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [144146] (1 PDB entry) Uniprot O43298 370-422! Uniprot O43298 423-486 |
Domain d2csha1: 2csh A:8-60 [130769] complexed with zn |
PDB Entry: 2csh (more details)
SCOP Domain Sequences for d2csha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} dklypcqcgksfthksqrdrhmsmhlglrpygcgvcgkkfkmkhhlvghmkih
Timeline for d2csha1: