Lineage for d2csha1 (2csh A:8-60)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035157Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 3035158Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 3035159Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)
  6. 3035353Protein Zinc finger protein 297b [144145] (1 species)
  7. 3035354Species Human (Homo sapiens) [TaxId:9606] [144146] (1 PDB entry)
    Uniprot O43298 370-422! Uniprot O43298 423-486
  8. 3035355Domain d2csha1: 2csh A:8-60 [130769]
    Other proteins in same PDB: d2csha3, d2csha4
    complexed with zn
    multiple common domains: applies to families that are inconsistently divided into domains

Details for d2csha1

PDB Entry: 2csh (more details)

PDB Description: solution structure of tandem repeat of the zf-c2h2 domains of human zinc finger protein 297b
PDB Compounds: (A:) Zinc finger protein 297B

SCOPe Domain Sequences for d2csha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]}
dklypcqcgksfthksqrdrhmsmhlglrpygcgvcgkkfkmkhhlvghmkih

SCOPe Domain Coordinates for d2csha1:

Click to download the PDB-style file with coordinates for d2csha1.
(The format of our PDB-style files is described here.)

Timeline for d2csha1: