SCOPe 2.08: Domain d2csga1: 2csg A:3-419

Lineage for d2csga1 (2csg A:3-419)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.12: YbiU-like [141636] (2 proteins)
   Pfam PF07350; DUF1479

6. Protein Hypothetical protein YbiU [141637] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [141638] (1 PDB entry)
   Uniprot Q8ZQM7 3-419

8. Domain d2csga1: 2csg A:3-419 [130768]
   complexed with cit, fe, ict, sin

Details for d2csga1

PDB Entry: 2csg, 2.9 Å

PDB Description: Crystal Structure of the Putative Oxidoreductase from Salmonella typhimurium LT2

PDB Compounds: (A:) putative cytoplasmic protein

SCOPe Domain Sequences for d2csga1:

Sequence; same for both SEQRES and ATOM records:

>d2csga1 b.82.2.12 (A:3-419) Hypothetical protein YbiU {Salmonella typhimurium [TaxId: 90371]}
tpfthetlpadpkaairqmkqalraqigdvqavfdrlsatiaarvaeindlkaqgqpvwp
iipfselamgnisdatraevkrrgcavikghfpreqalawdqsmldyldknhfdevykgp
gdnffgtlsasrpeiypvywsqaqmqarqseemalaqsflnrlwqvehdgkrwfnpdisi
iypdrirrrppgttskglgahtdsgalerwllpayqqvfasvfngnveqydpwnaahrtd
veeytvdnttkcsvfrtfqgwtalsdmlpgqgllhvvpipeamayillrpllddvpedel
cgvapgrvlpiseqwhpllmaaltsippleagdsvwwhcdvihsvapvenqqgwgnvmyi
paapmceknlayarkvkaaletgaspgdfpredyettwegrftlrdlnihgkralgi

Timeline for d2csga1:

• d2csga1 first appeared in SCOP 1.73
  
• d2csga1 appears in SCOPe 2.07