SCOPe 2.06: Domain d2csfa1: 2csf A:8-95

Lineage for d2csfa1 (2csf A:8-95)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.7: CUT domain [116891] (5 proteins)
   Pfam PF02376

6. Protein DNA-binding protein SATB2 [116894] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [116895] (2 PDB entries)
   Uniprot Q9UPW6 350-437; the structure of a homedomain (615-672) is also known: 1WI3

8. Domain d2csfa1: 2csf A:8-95 [130767]
   Other proteins in same PDB: d2csfa2, d2csfa3
   2nd CUT domain

Details for d2csfa1

PDB Entry: 2csf

PDB Description: solution structure of the second cut domain of human satb2

PDB Compounds: (A:) DNA-binding protein SATB2

SCOPe Domain Sequences for d2csfa1:

Sequence; same for both SEQRES and ATOM records:

>d2csfa1 a.35.1.7 (A:8-95) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]}
pikvdganinitaaiydeiqqemkrakvsqalfakvaanksqgwlcellrwkenpspenr
tlwenlctirrflnlpqherdviyeees

Timeline for d2csfa1:

• d2csfa1 first appeared in SCOP 1.73
  
• d2csfa1 appears in SCOPe 2.05
  
• d2csfa1 appears in SCOPe 2.07
  
• d2csfa1 appears in the current release, SCOPe 2.08