Lineage for d2csfa1 (2csf A:8-95)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709677Family a.35.1.7: CUT domain [116891] (5 proteins)
    Pfam PF02376
  6. 2709681Protein DNA-binding protein SATB2 [116894] (1 species)
  7. 2709682Species Human (Homo sapiens) [TaxId:9606] [116895] (2 PDB entries)
    Uniprot Q9UPW6 350-437; the structure of a homedomain (615-672) is also known: 1WI3
  8. 2709683Domain d2csfa1: 2csf A:8-95 [130767]
    Other proteins in same PDB: d2csfa2, d2csfa3
    2nd CUT domain

Details for d2csfa1

PDB Entry: 2csf (more details)

PDB Description: solution structure of the second cut domain of human satb2
PDB Compounds: (A:) DNA-binding protein SATB2

SCOPe Domain Sequences for d2csfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2csfa1 a.35.1.7 (A:8-95) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]}
pikvdganinitaaiydeiqqemkrakvsqalfakvaanksqgwlcellrwkenpspenr
tlwenlctirrflnlpqherdviyeees

SCOPe Domain Coordinates for d2csfa1:

Click to download the PDB-style file with coordinates for d2csfa1.
(The format of our PDB-style files is described here.)

Timeline for d2csfa1: