Lineage for d2cses1 (2cse S:1-365)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611780Fold d.196: Outer capsid protein sigma 3 [64464] (1 superfamily)
    unusual fold
  4. 2611781Superfamily d.196.1: Outer capsid protein sigma 3 [64465] (1 family) (S)
    automatically mapped to Pfam PF00979
  5. 2611782Family d.196.1.1: Outer capsid protein sigma 3 [64466] (1 protein)
  6. 2611783Protein Outer capsid protein sigma 3 [64467] (1 species)
  7. 2611784Species Reovirus [TaxId:10891] [64468] (3 PDB entries)
  8. 2611799Domain d2cses1: 2cse S:1-365 [130765]
    Other proteins in same PDB: d2cseu1
    automatically matched to d1jmug_

Details for d2cses1

PDB Entry: 2cse (more details), 7 Å

PDB Description: features of reovirus outer-capsid protein mu1 revealed by electron and image reconstruction of the virion at 7.0-a resolution
PDB Compounds: (S:) major capsid surface protein sigma-3

SCOPe Domain Sequences for d2cses1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cses1 d.196.1.1 (S:1-365) Outer capsid protein sigma 3 {Reovirus [TaxId: 10891]}
mevclpnghqivdlinnafegrvsiysaqegwdktisaqpdmmvcggavvcmhclgvvgs
lqrklkhlphhrcnqqirhqdyvdvqfadrvtahwkrgmlsfvcqmhammndvspedldr
vrteggslvelnwlqvdpnsmfrsihsswtdplqvvddldtkldqywtalnlmidssdlv
pnfmmrdpshafngvrlegdarqtqfsrtfdsrsslewgvmvydyselehdpskgrayrk
elvtpardfghfglshysrattpilgkmpavfsgmltgnckmypfikgtaklktvrklvd
svnhawgvekiryalgpggmtgwynrtmqqapivltpaaltmfsdttkfgdldypvmigd
pmilg

SCOPe Domain Coordinates for d2cses1:

Click to download the PDB-style file with coordinates for d2cses1.
(The format of our PDB-style files is described here.)

Timeline for d2cses1: