Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.196: Outer capsid protein sigma 3 [64464] (1 superfamily) unusual fold |
Superfamily d.196.1: Outer capsid protein sigma 3 [64465] (1 family) automatically mapped to Pfam PF00979 |
Family d.196.1.1: Outer capsid protein sigma 3 [64466] (1 protein) |
Protein Outer capsid protein sigma 3 [64467] (1 species) |
Species Reovirus [TaxId:10891] [64468] (3 PDB entries) |
Domain d2cses1: 2cse S:1-365 [130765] Other proteins in same PDB: d2cseu1 automatically matched to d1jmug_ |
PDB Entry: 2cse (more details), 7 Å
SCOPe Domain Sequences for d2cses1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cses1 d.196.1.1 (S:1-365) Outer capsid protein sigma 3 {Reovirus [TaxId: 10891]} mevclpnghqivdlinnafegrvsiysaqegwdktisaqpdmmvcggavvcmhclgvvgs lqrklkhlphhrcnqqirhqdyvdvqfadrvtahwkrgmlsfvcqmhammndvspedldr vrteggslvelnwlqvdpnsmfrsihsswtdplqvvddldtkldqywtalnlmidssdlv pnfmmrdpshafngvrlegdarqtqfsrtfdsrsslewgvmvydyselehdpskgrayrk elvtpardfghfglshysrattpilgkmpavfsgmltgnckmypfikgtaklktvrklvd svnhawgvekiryalgpggmtgwynrtmqqapivltpaaltmfsdttkfgdldypvmigd pmilg
Timeline for d2cses1: