Lineage for d2csen1 (2cse N:1-365)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 739567Fold d.196: Outer capsid protein sigma 3 [64464] (1 superfamily)
    unusual fold
  4. 739568Superfamily d.196.1: Outer capsid protein sigma 3 [64465] (1 family) (S)
  5. 739569Family d.196.1.1: Outer capsid protein sigma 3 [64466] (1 protein)
  6. 739570Protein Outer capsid protein sigma 3 [64467] (1 species)
  7. 739571Species Reovirus [TaxId:10891] [64468] (3 PDB entries)
  8. 739584Domain d2csen1: 2cse N:1-365 [130763]
    Other proteins in same PDB: d2cseu1
    automatically matched to d1jmug_

Details for d2csen1

PDB Entry: 2cse (more details), 7 Å

PDB Description: features of reovirus outer-capsid protein mu1 revealed by electron and image reconstruction of the virion at 7.0-a resolution
PDB Compounds: (N:) major capsid surface protein sigma-3

SCOP Domain Sequences for d2csen1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2csen1 d.196.1.1 (N:1-365) Outer capsid protein sigma 3 {Reovirus [TaxId: 10891]}
mevclpnghqivdlinnafegrvsiysaqegwdktisaqpdmmvcggavvcmhclgvvgs
lqrklkhlphhrcnqqirhqdyvdvqfadrvtahwkrgmlsfvcqmhammndvspedldr
vrteggslvelnwlqvdpnsmfrsihsswtdplqvvddldtkldqywtalnlmidssdlv
pnfmmrdpshafngvrlegdarqtqfsrtfdsrsslewgvmvydyselehdpskgrayrk
elvtpardfghfglshysrattpilgkmpavfsgmltgnckmypfikgtaklktvrklvd
svnhawgvekiryalgpggmtgwynrtmqqapivltpaaltmfsdttkfgdldypvmigd
pmilg

SCOP Domain Coordinates for d2csen1:

Click to download the PDB-style file with coordinates for d2csen1.
(The format of our PDB-style files is described here.)

Timeline for d2csen1: