Lineage for d2cseh1 (2cse H:1-365)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005885Fold d.196: Outer capsid protein sigma 3 [64464] (1 superfamily)
    unusual fold
  4. 3005886Superfamily d.196.1: Outer capsid protein sigma 3 [64465] (1 family) (S)
    automatically mapped to Pfam PF00979
  5. 3005887Family d.196.1.1: Outer capsid protein sigma 3 [64466] (1 protein)
  6. 3005888Protein Outer capsid protein sigma 3 [64467] (1 species)
  7. 3005889Species Reovirus [TaxId:10891] [64468] (3 PDB entries)
  8. 3005899Domain d2cseh1: 2cse H:1-365 [130760]
    Other proteins in same PDB: d2cseu1
    automatically matched to d1jmug_

Details for d2cseh1

PDB Entry: 2cse (more details)

PDB Description: features of reovirus outer-capsid protein mu1 revealed by electron and image reconstruction of the virion at 7.0-a resolution
PDB Compounds: (H:) major capsid surface protein sigma-3

SCOPe Domain Sequences for d2cseh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cseh1 d.196.1.1 (H:1-365) Outer capsid protein sigma 3 {Reovirus [TaxId: 10891]}
mevclpnghqivdlinnafegrvsiysaqegwdktisaqpdmmvcggavvcmhclgvvgs
lqrklkhlphhrcnqqirhqdyvdvqfadrvtahwkrgmlsfvcqmhammndvspedldr
vrteggslvelnwlqvdpnsmfrsihsswtdplqvvddldtkldqywtalnlmidssdlv
pnfmmrdpshafngvrlegdarqtqfsrtfdsrsslewgvmvydyselehdpskgrayrk
elvtpardfghfglshysrattpilgkmpavfsgmltgnckmypfikgtaklktvrklvd
svnhawgvekiryalgpggmtgwynrtmqqapivltpaaltmfsdttkfgdldypvmigd
pmilg

SCOPe Domain Coordinates for d2cseh1:

Click to download the PDB-style file with coordinates for d2cseh1.
(The format of our PDB-style files is described here.)

Timeline for d2cseh1: