![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.60: SAM domain-like [47768] (15 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.2: RuvA domain 2-like [47781] (5 families) ![]() duplication: contains two helix-hairpin-helix (HhH) motifs |
![]() | Family a.60.2.4: Topoisomerase V repeat domain [140626] (1 protein) this is a repeat family; one repeat unit is 2csb A:351-409 found in domain |
![]() | Protein Topoisomerase V [140627] (1 species) |
![]() | Species Methanopyrus kandleri [TaxId:2320] [140628] (1 PDB entry) |
![]() | Domain d2csba4: 2csb A:465-519 [130754] Other proteins in same PDB: d2csba5 4th repeat complexed with mg |
PDB Entry: 2csb (more details), 2.3 Å
SCOP Domain Sequences for d2csba4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2csba4 a.60.2.4 (A:465-519) Topoisomerase V {Methanopyrus kandleri [TaxId: 2320]} pgyaslisirgidreraerllkkyggyskvreagveelredgltdaqirelkglk
Timeline for d2csba4:
![]() Domains from same chain: (mouse over for more information) d2csba1, d2csba2, d2csba3, d2csba5 |