Lineage for d2csba2 (2csb A:294-350)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642790Fold a.60: SAM domain-like [47768] (15 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 642894Superfamily a.60.2: RuvA domain 2-like [47781] (5 families) (S)
    duplication: contains two helix-hairpin-helix (HhH) motifs
  5. 642930Family a.60.2.4: Topoisomerase V repeat domain [140626] (1 protein)
  6. 642931Protein Topoisomerase V [140627] (1 species)
  7. 642932Species Methanopyrus kandleri [TaxId:2320] [140628] (1 PDB entry)
  8. 642934Domain d2csba2: 2csb A:294-350 [130752]
    Other proteins in same PDB: d2csba5
    1st repeat
    complexed with mg

Details for d2csba2

PDB Entry: 2csb (more details), 2.3 Å

PDB Description: crystal structure of topoisomerase v from methanopyrus kandleri (61 kda fragment)
PDB Compounds: (A:) Topoisomerase V

SCOP Domain Sequences for d2csba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2csba2 a.60.2.4 (A:294-350) Topoisomerase V {Methanopyrus kandleri [TaxId: 2320]}
ivecalklqdrygiredvalclarafdgsismiattpyrtlkdvcpdltleeaksvn

SCOP Domain Coordinates for d2csba2:

Click to download the PDB-style file with coordinates for d2csba2.
(The format of our PDB-style files is described here.)

Timeline for d2csba2: