Lineage for d2crza1 (2crz A:8-104)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2358952Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2358953Family b.1.2.1: Fibronectin type III [49266] (45 protein domains)
    Pfam PF00041
  6. 2359140Protein Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) [117057] (1 species)
  7. 2359141Species Human (Homo sapiens) [TaxId:9606] [117058] (6 PDB entries)
    Uniprot Q9Y2H6 192-315
  8. 2359143Domain d2crza1: 2crz A:8-104 [130743]
    Other proteins in same PDB: d2crza2, d2crza3

Details for d2crza1

PDB Entry: 2crz (more details)

PDB Description: Solution structure of the fifth FNIII domain of human fibronectin type III domain containing protein 3a
PDB Compounds: (A:) Fibronectin type-III domain containing protein 3a

SCOPe Domain Sequences for d2crza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}
ppgpclpprlqgrpkakeiqlrwgpplvdggspiscysvemspiekdeprevyqgsevec
tvssllpgktysfrlraankmgfgpfsekcdittapg

SCOPe Domain Coordinates for d2crza1:

Click to download the PDB-style file with coordinates for d2crza1.
(The format of our PDB-style files is described here.)

Timeline for d2crza1: