Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) [117057] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117058] (6 PDB entries) Uniprot Q9Y2H6 192-315 |
Domain d2crza1: 2crz A:8-104 [130743] Other proteins in same PDB: d2crza2, d2crza3 |
PDB Entry: 2crz (more details)
SCOPe Domain Sequences for d2crza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} ppgpclpprlqgrpkakeiqlrwgpplvdggspiscysvemspiekdeprevyqgsevec tvssllpgktysfrlraankmgfgpfsekcdittapg
Timeline for d2crza1: