Lineage for d2crua1 (2cru A:8-112)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696009Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2696285Superfamily a.5.6: Double-stranded DNA-binding domain [46950] (1 family) (S)
    automatically mapped to Pfam PF01984
  5. 2696286Family a.5.6.1: Double-stranded DNA-binding domain [46951] (2 proteins)
  6. 2696290Protein Programmed cell death protein 5 [140348] (1 species)
  7. 2696291Species Human (Homo sapiens) [TaxId:9606] [140349] (1 PDB entry)
    Uniprot O14737 8-112
  8. 2696292Domain d2crua1: 2cru A:8-112 [130742]
    Other proteins in same PDB: d2crua2, d2crua3

Details for d2crua1

PDB Entry: 2cru (more details)

PDB Description: solution structure of programmed cell death 5
PDB Compounds: (A:) Programmed cell death protein 5

SCOPe Domain Sequences for d2crua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2crua1 a.5.6.1 (A:8-112) Programmed cell death protein 5 {Human (Homo sapiens) [TaxId: 9606]}
lrrqrlaelqakhgdpgdaaqqeakhreaemrnsilaqvldqsararlsnlalvkpektk
avenyliqmarygqlsekvseqglieilkkvsqqtektttvkfnr

SCOPe Domain Coordinates for d2crua1:

Click to download the PDB-style file with coordinates for d2crua1.
(The format of our PDB-style files is described here.)

Timeline for d2crua1: