![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
![]() | Superfamily a.5.6: Double-stranded DNA-binding domain [46950] (1 family) ![]() automatically mapped to Pfam PF01984 |
![]() | Family a.5.6.1: Double-stranded DNA-binding domain [46951] (2 proteins) |
![]() | Protein Programmed cell death protein 5 [140348] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [140349] (1 PDB entry) Uniprot O14737 8-112 |
![]() | Domain d2crua1: 2cru A:8-112 [130742] Other proteins in same PDB: d2crua2, d2crua3 |
PDB Entry: 2cru (more details)
SCOPe Domain Sequences for d2crua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2crua1 a.5.6.1 (A:8-112) Programmed cell death protein 5 {Human (Homo sapiens) [TaxId: 9606]} lrrqrlaelqakhgdpgdaaqqeakhreaemrnsilaqvldqsararlsnlalvkpektk avenyliqmarygqlsekvseqglieilkkvsqqtektttvkfnr
Timeline for d2crua1: