Class a: All alpha proteins [46456] (289 folds) |
Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
Superfamily a.5.2: UBA-like [46934] (5 families) |
Family a.5.2.1: UBA domain [46935] (25 proteins) |
Protein Suppressor of T-cell receptor signaling 2 (STS-2) [140335] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [140336] (1 PDB entry) Uniprot P57075 20-70 |
Domain d2crna1: 2crn A:8-58 [130741] Other proteins in same PDB: d2crna2, d2crna3 |
PDB Entry: 2crn (more details)
SCOPe Domain Sequences for d2crna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} sspsllepllamgfpvhtalkalaatgrktaeealawlhdhcndpslddpi
Timeline for d2crna1: