Lineage for d2crna1 (2crn A:8-58)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 763589Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 763613Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 763614Family a.5.2.1: UBA domain [46935] (24 proteins)
  6. 763684Protein Suppressor of T-cell receptor signaling 2 (STS-2) [140335] (1 species)
  7. 763685Species Human (Homo sapiens) [TaxId:9606] [140336] (1 PDB entry)
    Uniprot P57075 20-70
  8. 763686Domain d2crna1: 2crn A:8-58 [130741]

Details for d2crna1

PDB Entry: 2crn (more details)

PDB Description: solution structure of the uba domain of human ubash3a protein
PDB Compounds: (A:) UBASH3A protein

SCOP Domain Sequences for d2crna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]}
sspsllepllamgfpvhtalkalaatgrktaeealawlhdhcndpslddpi

SCOP Domain Coordinates for d2crna1:

Click to download the PDB-style file with coordinates for d2crna1.
(The format of our PDB-style files is described here.)

Timeline for d2crna1: