Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) [117057] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117058] (6 PDB entries) Uniprot Q9Y2H6 192-315 |
Domain d2crma1: 2crm A:8-114 [130740] Other proteins in same PDB: d2crma2, d2crma3 |
PDB Entry: 2crm (more details)
SCOPe Domain Sequences for d2crma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} vvefttcpdkpgipvkpsvkgkihshsfkitwdppkdnggatinkyvvemaegsngnkwe miysgatrehlcdrlnpgcfyrlrvycisdggqsavsesllvqtpav
Timeline for d2crma1: