Lineage for d2crma1 (2crm A:8-114)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2035676Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2035677Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2035864Protein Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) [117057] (1 species)
  7. 2035865Species Human (Homo sapiens) [TaxId:9606] [117058] (6 PDB entries)
    Uniprot Q9Y2H6 192-315
  8. 2035870Domain d2crma1: 2crm A:8-114 [130740]
    Other proteins in same PDB: d2crma2, d2crma3

Details for d2crma1

PDB Entry: 2crm (more details)

PDB Description: solution structure of the forth fniii domain of human
PDB Compounds: (A:) Fibronectin type-III domain containing protein 3a

SCOPe Domain Sequences for d2crma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}
vvefttcpdkpgipvkpsvkgkihshsfkitwdppkdnggatinkyvvemaegsngnkwe
miysgatrehlcdrlnpgcfyrlrvycisdggqsavsesllvqtpav

SCOPe Domain Coordinates for d2crma1:

Click to download the PDB-style file with coordinates for d2crma1.
(The format of our PDB-style files is described here.)

Timeline for d2crma1: