Lineage for d2crga1 (2crg A:8-64)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692037Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)
  6. 2692077Protein Metastasis associated protein MTA3 [140163] (1 species)
  7. 2692078Species Mouse (Mus musculus) [TaxId:10090] [140164] (1 PDB entry)
    Uniprot Q924K8 267-323
  8. 2692079Domain d2crga1: 2crg A:8-64 [130739]
    Other proteins in same PDB: d2crga2, d2crga3

Details for d2crga1

PDB Entry: 2crg (more details)

PDB Description: solution structure of the myb-like dna-binding domain of mouse mta3 protein
PDB Compounds: (A:) Metastasis associated protein MTA3

SCOPe Domain Sequences for d2crga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]}
meewsaseaclfeealekygkdfndirqdflpwksltsiieyyymwkttdryvqqkr

SCOPe Domain Coordinates for d2crga1:

Click to download the PDB-style file with coordinates for d2crga1.
(The format of our PDB-style files is described here.)

Timeline for d2crga1: