Lineage for d2crfa1 (2crf A:8-144)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803450Family b.55.1.3: Ran-binding domain [50764] (5 proteins)
  6. 2803455Protein Ran binding protein 3 [141426] (1 species)
  7. 2803456Species Human (Homo sapiens) [TaxId:9606] [141427] (1 PDB entry)
    Uniprot Q9H6Z4 380-516
  8. 2803457Domain d2crfa1: 2crf A:8-144 [130738]
    Other proteins in same PDB: d2crfa2, d2crfa3

Details for d2crfa1

PDB Entry: 2crf (more details)

PDB Description: solution structure of the ran_bp1 domain of ran-binding protein-3
PDB Compounds: (A:) RAN binding protein 3

SCOPe Domain Sequences for d2crfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2crfa1 b.55.1.3 (A:8-144) Ran binding protein 3 {Human (Homo sapiens) [TaxId: 9606]}
tarkcllekvevitgeeaesnvlqmqcklfvfdktsqswvergrgllrlndmastddgtl
qsrlvmrtqgslrlilntklwaqmqidkaseksihitamdtedqgvkvflisasskdtgq
lyaalhhrilalrsrve

SCOPe Domain Coordinates for d2crfa1:

Click to download the PDB-style file with coordinates for d2crfa1.
(The format of our PDB-style files is described here.)

Timeline for d2crfa1: