Lineage for d2craa1 (2cra A:8-64)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691847Protein Homeobox protein hox-b13 [140161] (1 species)
  7. 2691848Species Human (Homo sapiens) [TaxId:9606] [140162] (1 PDB entry)
    Uniprot Q92826 216-273
  8. 2691849Domain d2craa1: 2cra A:8-64 [130736]
    Other proteins in same PDB: d2craa2, d2craa3

Details for d2craa1

PDB Entry: 2cra (more details)

PDB Description: solution structure of the homeobox domain of human homeo box b13
PDB Compounds: (A:) Homeobox protein Hox-B13

SCOPe Domain Sequences for d2craa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2craa1 a.4.1.1 (A:8-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]}
rkkripyskgqlrelereyaankfitkdkrrkisaatslserqitiwfqnrrvkekk

SCOPe Domain Coordinates for d2craa1:

Click to download the PDB-style file with coordinates for d2craa1.
(The format of our PDB-style files is described here.)

Timeline for d2craa1: