![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
![]() | Protein Homeobox protein hox-b13 [140161] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [140162] (1 PDB entry) Uniprot Q92826 216-273 |
![]() | Domain d2craa1: 2cra A:8-64 [130736] Other proteins in same PDB: d2craa2, d2craa3 |
PDB Entry: 2cra (more details)
SCOPe Domain Sequences for d2craa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2craa1 a.4.1.1 (A:8-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} rkkripyskgqlrelereyaankfitkdkrrkisaatslserqitiwfqnrrvkekk
Timeline for d2craa1: