![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.297: WGR domain-like [142920] (1 superfamily) beta(4)-alpha-X-beta; 2 layers, a/b; antiparallel beta-sheet, order 51234; the beta-hairpin insetrion in strand 1 results in the formation of a beta-triangle structure |
![]() | Superfamily d.297.1: WGR domain-like [142921] (1 family) ![]() |
![]() | Family d.297.1.1: WGR domain [142922] (1 protein) Pfam PF05406; the conserved WGR motif maps to the C-end of strand 3, both large sidechains are exposed |
![]() | Protein Poly [ADP-ribose] polymerase-1, PARP-1 [142923] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142924] (1 PDB entry) Uniprot P09874 517-642 |
![]() | Domain d2cr9a1: 2cr9 A:8-133 [130735] Other proteins in same PDB: d2cr9a2, d2cr9a3 |
PDB Entry: 2cr9 (more details)
SCOPe Domain Sequences for d2cr9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cr9a1 d.297.1.1 (A:8-133) Poly [ADP-ribose] polymerase-1, PARP-1 {Human (Homo sapiens) [TaxId: 9606]} ksekrmkltlkggaavdpdsglehsahvlekggkvfsatlglvdivkgtnsyyklqlled dkenrywifrswgrvgtvigsnkleqmpskedaiehfmklyeektgnawhsknftkypkk fyplei
Timeline for d2cr9a1: