Lineage for d2cr8a1 (2cr8 A:8-47)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3037321Superfamily g.41.11: Ran binding protein zinc finger-like [90209] (2 families) (S)
    contains CxxxxC-x(n)-CxxC zinc-binding site; similar to the Sec23/24 zinc finger domain
  5. 3037322Family g.41.11.1: Ran binding protein zinc finger-like [90210] (7 proteins)
  6. 3037327Protein MDM4 [144196] (1 species)
  7. 3037328Species Human (Homo sapiens) [TaxId:9606] [144197] (1 PDB entry)
    Uniprot O15151 300-340
  8. 3037329Domain d2cr8a1: 2cr8 A:8-47 [130734]
    Other proteins in same PDB: d2cr8a2, d2cr8a3
    complexed with zn

Details for d2cr8a1

PDB Entry: 2cr8 (more details)

PDB Description: solution structure of the zf-ranbp domain of p53-binding protein mdm4
PDB Compounds: (A:) mdm4 protein

SCOPe Domain Sequences for d2cr8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cr8a1 g.41.11.1 (A:8-47) MDM4 {Human (Homo sapiens) [TaxId: 9606]}
sedewqcteckkfnspskrycfrcwalrkdwysdcsklth

SCOPe Domain Coordinates for d2cr8a1:

Click to download the PDB-style file with coordinates for d2cr8a1.
(The format of our PDB-style files is described here.)

Timeline for d2cr8a1: