![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.11: Ran binding protein zinc finger-like [90209] (2 families) ![]() contains CxxxxC-x(n)-CxxC zinc-binding site; similar to the Sec23/24 zinc finger domain |
![]() | Family g.41.11.1: Ran binding protein zinc finger-like [90210] (7 proteins) |
![]() | Protein MDM4 [144196] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [144197] (1 PDB entry) Uniprot O15151 300-340 |
![]() | Domain d2cr8a1: 2cr8 A:8-47 [130734] Other proteins in same PDB: d2cr8a2, d2cr8a3 complexed with zn |
PDB Entry: 2cr8 (more details)
SCOPe Domain Sequences for d2cr8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cr8a1 g.41.11.1 (A:8-47) MDM4 {Human (Homo sapiens) [TaxId: 9606]} sedewqcteckkfnspskrycfrcwalrkdwysdcsklth
Timeline for d2cr8a1: