Lineage for d2cr5a1 (2cr5 A:8-103)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717081Superfamily d.15.1: Ubiquitin-like [54236] (7 families) (S)
  5. 717355Family d.15.1.2: UBX domain [54250] (5 proteins)
    Pfam PF00789
  6. 717372Protein UBX domain-containing protein 6 (Reproduction 8) [142956] (1 species)
  7. 717373Species Mouse (Mus musculus) [TaxId:10090] [142957] (1 PDB entry)
  8. 717374Domain d2cr5a1: 2cr5 A:8-103 [130733]

Details for d2cr5a1

PDB Entry: 2cr5 (more details)

PDB Description: solution structure of the ubx domain of d0h8s2298e protein
PDB Compounds: (A:) Reproduction 8

SCOP Domain Sequences for d2cr5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]}
evpdlpeepsetaeevvtvalrcpngrvlrrrffkswnsqvlldwmmkvgyhkslyrlst
sfprraleveggssledigitvdtvlnveekeqssq

SCOP Domain Coordinates for d2cr5a1:

Click to download the PDB-style file with coordinates for d2cr5a1.
(The format of our PDB-style files is described here.)

Timeline for d2cr5a1: