Lineage for d2cr5a1 (2cr5 A:8-103)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2932685Family d.15.1.2: UBX domain [54250] (6 proteins)
    Pfam PF00789
  6. 2932702Protein UBX domain-containing protein 6 (Reproduction 8) [142956] (1 species)
  7. 2932703Species Mouse (Mus musculus) [TaxId:10090] [142957] (1 PDB entry)
    Uniprot Q9QZ49 182-277
  8. 2932704Domain d2cr5a1: 2cr5 A:8-103 [130733]
    Other proteins in same PDB: d2cr5a2, d2cr5a3

Details for d2cr5a1

PDB Entry: 2cr5 (more details)

PDB Description: solution structure of the ubx domain of d0h8s2298e protein
PDB Compounds: (A:) Reproduction 8

SCOPe Domain Sequences for d2cr5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]}
evpdlpeepsetaeevvtvalrcpngrvlrrrffkswnsqvlldwmmkvgyhkslyrlst
sfprraleveggssledigitvdtvlnveekeqssq

SCOPe Domain Coordinates for d2cr5a1:

Click to download the PDB-style file with coordinates for d2cr5a1.
(The format of our PDB-style files is described here.)

Timeline for d2cr5a1: