Lineage for d2cqxa1 (2cqx A:8-66)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634287Superfamily a.4.1: Homeodomain-like [46689] (17 families) (S)
    consists only of helices
  5. 634288Family a.4.1.1: Homeodomain [46690] (39 proteins)
    Pfam PF00046
  6. 634379Protein LAG1 longevity assurance homolog 5, LASS5 [140141] (1 species)
  7. 634380Species Mouse (Mus musculus) [TaxId:10090] [140142] (1 PDB entry)
  8. 634381Domain d2cqxa1: 2cqx A:8-66 [130731]

Details for d2cqxa1

PDB Entry: 2cqx (more details)

PDB Description: solution structure of rsgi ruh-034, a homeodomain from mouse cdna
PDB Compounds: (A:) LAG1 longevity assurance homolog 5

SCOP Domain Sequences for d2cqxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]}
gikdspvnkvepndtlekvfvsvtkypdekrlkglskqldwsvrkiqcwfrhrrnqdkp

SCOP Domain Coordinates for d2cqxa1:

Click to download the PDB-style file with coordinates for d2cqxa1.
(The format of our PDB-style files is described here.)

Timeline for d2cqxa1: