![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
![]() | Protein LAG1 longevity assurance homolog 5, LASS5 [140141] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [140142] (1 PDB entry) Uniprot Q9D6K9 77-135 |
![]() | Domain d2cqxa1: 2cqx A:8-66 [130731] Other proteins in same PDB: d2cqxa2, d2cqxa3 |
PDB Entry: 2cqx (more details)
SCOPe Domain Sequences for d2cqxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} gikdspvnkvepndtlekvfvsvtkypdekrlkglskqldwsvrkiqcwfrhrrnqdkp
Timeline for d2cqxa1: