Lineage for d2cqva1 (2cqv A:8-108)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 787055Family b.1.1.4: I set domains [49159] (38 proteins)
  6. 787384Protein Telokin [49170] (2 species)
  7. 787385Species Human (Homo sapiens) [TaxId:9606] [141012] (1 PDB entry)
    Uniprot Q9UIT9 1238-1338
  8. 787386Domain d2cqva1: 2cqv A:8-108 [130730]

Details for d2cqva1

PDB Entry: 2cqv (more details)

PDB Description: Solution structure of the eighth Ig-like domain of human myosin light chain kinase
PDB Compounds: (A:) Myosin light chain kinase, smooth muscle and non-muscle isozymes

SCOP Domain Sequences for d2cqva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]}
pqiiqfpedqkvragesvelfgkvtgtqpitctwmkfrkqiqesehmkvensengsklti
laarqehcgcytllvenklgsrqaqvnltvvdkpdppagtp

SCOP Domain Coordinates for d2cqva1:

Click to download the PDB-style file with coordinates for d2cqva1.
(The format of our PDB-style files is described here.)

Timeline for d2cqva1: