Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.3: Myb/SANT domain [46739] (16 proteins) |
Protein DnaJ homolog subfamily C member 1 [140169] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [140170] (2 PDB entries) Uniprot Q96KC8 327-385! Uniprot Q96KC8 484-543 |
Domain d2cqra1: 2cqr A:8-66 [130729] Other proteins in same PDB: d2cqra2, d2cqra3 2nd Myb domain |
PDB Entry: 2cqr (more details)
SCOPe Domain Sequences for d2cqra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cqra1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} slrkerarsaeepwtqnqqkllelalqqyprgssdcwdkiarcvpskskedciarykll
Timeline for d2cqra1: