Lineage for d2cqra1 (2cqr A:8-66)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692037Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)
  6. 2692070Protein DnaJ homolog subfamily C member 1 [140169] (1 species)
  7. 2692071Species Human (Homo sapiens) [TaxId:9606] [140170] (2 PDB entries)
    Uniprot Q96KC8 327-385! Uniprot Q96KC8 484-543
  8. 2692073Domain d2cqra1: 2cqr A:8-66 [130729]
    Other proteins in same PDB: d2cqra2, d2cqra3
    2nd Myb domain

Details for d2cqra1

PDB Entry: 2cqr (more details)

PDB Description: solution structure of rsgi ruh-043, a myb dna-binding domain in human cdna
PDB Compounds: (A:) DnaJ homolog subfamily C member 1

SCOPe Domain Sequences for d2cqra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cqra1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]}
slrkerarsaeepwtqnqqkllelalqqyprgssdcwdkiarcvpskskedciarykll

SCOPe Domain Coordinates for d2cqra1:

Click to download the PDB-style file with coordinates for d2cqra1.
(The format of our PDB-style files is described here.)

Timeline for d2cqra1: