Lineage for d2cqpa1 (2cqp A:917-1002)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724300Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 724301Family d.58.7.1: Canonical RBD [54929] (67 proteins)
  6. 724530Protein RNA-binding protein 12 [143349] (2 species)
    3rd RBD
  7. 724534Species Mouse (Mus musculus) [TaxId:10090] [143351] (1 PDB entry)
  8. 724535Domain d2cqpa1: 2cqp A:917-1002 [130727]
    C-terminal (4th) RBD

Details for d2cqpa1

PDB Entry: 2cqp (more details)

PDB Description: solution structure of the rna binding domain of rna-binding protein 12
PDB Compounds: (A:) RNA-binding protein 12

SCOP Domain Sequences for d2cqpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]}
gassgkpgptiikvqnmpftvsideildffygyqvipgsvclkynekgmptgeamvafes
rdeataavidlndrpigsrkvklvlg

SCOP Domain Coordinates for d2cqpa1:

Click to download the PDB-style file with coordinates for d2cqpa1.
(The format of our PDB-style files is described here.)

Timeline for d2cqpa1: