Lineage for d2cqna1 (2cqn A:743-806)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735563Fold a.159: Another 3-helical bundle [81602] (5 superfamilies)
    topologically similar to the DNA/RNA-binding bundles; distinct packing
  4. 2735580Superfamily a.159.2: FF domain [81698] (1 family) (S)
  5. 2735581Family a.159.2.1: FF domain [81699] (4 proteins)
  6. 2735582Protein Hypa/FBP11 [81700] (1 species)
  7. 2735583Species Human (Homo sapiens) [TaxId:9606] [81701] (2 PDB entries)
    Flj21157
  8. 2735585Domain d2cqna1: 2cqn A:743-806 [130726]
    Other proteins in same PDB: d2cqna2, d2cqna3
    the last (5th) FF domain

Details for d2cqna1

PDB Entry: 2cqn (more details)

PDB Description: solution structure of the ff domain of human formin-binding protein 3
PDB Compounds: (A:) Formin-binding protein 3

SCOPe Domain Sequences for d2cqna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cqna1 a.159.2.1 (A:743-806) Hypa/FBP11 {Human (Homo sapiens) [TaxId: 9606]}
mkrkesafksmlkqaappieldavwedirerfvkepafeditleserkrifkdfmhvleh
ecqh

SCOPe Domain Coordinates for d2cqna1:

Click to download the PDB-style file with coordinates for d2cqna1.
(The format of our PDB-style files is described here.)

Timeline for d2cqna1: