Class a: All alpha proteins [46456] (290 folds) |
Fold a.159: Another 3-helical bundle [81602] (5 superfamilies) topologically similar to the DNA/RNA-binding bundles; distinct packing |
Superfamily a.159.2: FF domain [81698] (1 family) |
Family a.159.2.1: FF domain [81699] (4 proteins) |
Protein Hypa/FBP11 [81700] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [81701] (2 PDB entries) Flj21157 |
Domain d2cqna1: 2cqn A:743-806 [130726] Other proteins in same PDB: d2cqna2, d2cqna3 the last (5th) FF domain |
PDB Entry: 2cqn (more details)
SCOPe Domain Sequences for d2cqna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cqna1 a.159.2.1 (A:743-806) Hypa/FBP11 {Human (Homo sapiens) [TaxId: 9606]} mkrkesafksmlkqaappieldavwedirerfvkepafeditleserkrifkdfmhvleh ecqh
Timeline for d2cqna1: