SCOPe 2.06: Domain d2cqka1: 2cqk A:43-130

Lineage for d2cqka1 (2cqk A:43-130)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.46: La domain [101051] (2 proteins)
   Pfam PF05383; RNA-binding domain

6. Protein La-related protein 4 LARP4 [140271] (1 species)
   C-mpl binding protein

7. Species Human (Homo sapiens) [TaxId:9606] [140272] (1 PDB entry)
   Uniprot Q71RC2 112-199

8. Domain d2cqka1: 2cqk A:43-130 [130725]
   Other proteins in same PDB: d2cqka2, d2cqka3

Details for d2cqka1

PDB Entry: 2cqk

PDB Description: solution structure of the la domain of c-mpl binding protein

PDB Compounds: (A:) C-Mpl binding protein

SCOPe Domain Sequences for d2cqka1:

Sequence; same for both SEQRES and ATOM records:

>d2cqka1 a.4.5.46 (A:43-130) La-related protein 4 LARP4 {Human (Homo sapiens) [TaxId: 9606]}
avstedlkeclkkqlefcfsrenlskdlylisqmdsdqfipiwtvanmeeikklttdpdl
ilevlrsspmvqvdekgekvrpshkrci

Timeline for d2cqka1:

• d2cqka1 first appeared in SCOP 1.73
  
• d2cqka1 appears in SCOPe 2.05
  
• d2cqka1 appears in SCOPe 2.07
  
• d2cqka1 appears in the current release, SCOPe 2.08