Lineage for d2cqha1 (2cqh A:2-81)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908521Protein IGF-II mRNA-binding protein 2 isoform A [143344] (1 species)
  7. 1908522Species Human (Homo sapiens) [TaxId:9606] [143345] (1 PDB entry)
    Uniprot Q9Y6M1 2-81
  8. 1908523Domain d2cqha1: 2cqh A:2-81 [130723]
    1st RBD

Details for d2cqha1

PDB Entry: 2cqh (more details)

PDB Description: solution structure of the rna binding domain of igf-ii mrna-binding protein 2
PDB Compounds: (A:) IGF-II mRNA-binding protein 2 isoform a

SCOPe Domain Sequences for d2cqha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]}
mnklyignlspavtaddlrqlfgdrklplagqvllksgyafvdypdqnwairaietlsgk
velhgkimevdysvskklrs

SCOPe Domain Coordinates for d2cqha1:

Click to download the PDB-style file with coordinates for d2cqha1.
(The format of our PDB-style files is described here.)

Timeline for d2cqha1: