Lineage for d2cqga1 (2cqg A:96-185)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952307Protein TAR DNA-binding protein 43, TDP-43 [117957] (1 species)
  7. 2952308Species Human (Homo sapiens) [TaxId:9606] [117958] (2 PDB entries)
    Uniprot Q13148 193-267
  8. 2952309Domain d2cqga1: 2cqg A:96-185 [130722]
    Other proteins in same PDB: d2cqga2, d2cqga3

Details for d2cqga1

PDB Entry: 2cqg (more details)

PDB Description: solution structure of the rna binding domain of tar dna-binding protein-43
PDB Compounds: (A:) TAR DNA-binding protein-43

SCOPe Domain Sequences for d2cqga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]}
vkravqktsdlivlglpwktteqdlkeyfstfgevlmvqvkkdlktghskgfgfvrftey
etqvkvmsqrhmidgrwcdcklpnskqsqd

SCOPe Domain Coordinates for d2cqga1:

Click to download the PDB-style file with coordinates for d2cqga1.
(The format of our PDB-style files is described here.)

Timeline for d2cqga1: