![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein TAR DNA-binding protein 43, TDP-43 [117957] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117958] (2 PDB entries) Uniprot Q13148 193-267 |
![]() | Domain d2cqga1: 2cqg A:96-185 [130722] Other proteins in same PDB: d2cqga2, d2cqga3 |
PDB Entry: 2cqg (more details)
SCOPe Domain Sequences for d2cqga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} vkravqktsdlivlglpwktteqdlkeyfstfgevlmvqvkkdlktghskgfgfvrftey etqvkvmsqrhmidgrwcdcklpnskqsqd
Timeline for d2cqga1: