Class g: Small proteins [56992] (100 folds) |
Fold g.66: CCCH zinc finger [90228] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.66.1: CCCH zinc finger [90229] (2 families) |
Family g.66.1.1: CCCH zinc finger [90230] (4 proteins) C-x8-C-x5-C-x3-H type and similar |
Protein Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) [144243] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [144244] (1 PDB entry) Uniprot Q9UPT8 417-445! Uniprot Q9UPT8 446-501 |
Domain d2cqea1: 2cqe A:458-513 [130720] Other proteins in same PDB: d2cqea3, d2cqea4 3rd C3H1-type finger; includes extra C-terminal helix complexed with zn |
PDB Entry: 2cqe (more details)
SCOPe Domain Sequences for d2cqea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cqea1 g.66.1.1 (A:458-513) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} fpcklyhttgncingddcmfshdplteetrelldkmladdaeagaedekeveelkk
Timeline for d2cqea1: