Lineage for d2cqea1 (2cqe A:458-513)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038401Fold g.66: CCCH zinc finger [90228] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 3038402Superfamily g.66.1: CCCH zinc finger [90229] (2 families) (S)
  5. 3038403Family g.66.1.1: CCCH zinc finger [90230] (4 proteins)
    C-x8-C-x5-C-x3-H type and similar
  6. 3038414Protein Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) [144243] (1 species)
  7. 3038415Species Human (Homo sapiens) [TaxId:9606] [144244] (1 PDB entry)
    Uniprot Q9UPT8 417-445! Uniprot Q9UPT8 446-501
  8. 3038416Domain d2cqea1: 2cqe A:458-513 [130720]
    Other proteins in same PDB: d2cqea3, d2cqea4
    3rd C3H1-type finger; includes extra C-terminal helix
    complexed with zn

Details for d2cqea1

PDB Entry: 2cqe (more details)

PDB Description: solution structure of the zinc-finger domain in kiaa1064 protein
PDB Compounds: (A:) KIAA1064 protein

SCOPe Domain Sequences for d2cqea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cqea1 g.66.1.1 (A:458-513) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]}
fpcklyhttgncingddcmfshdplteetrelldkmladdaeagaedekeveelkk

SCOPe Domain Coordinates for d2cqea1:

Click to download the PDB-style file with coordinates for d2cqea1.
(The format of our PDB-style files is described here.)

Timeline for d2cqea1: